PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G17110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 531aa    MW: 58997.1 Da    PI: 4.6637
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G17110.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591.1e-18102149148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ed++l d+v+ +G g+W+ + r  g++R++k+c++rw ++l
  LPERR06G17110.1 102 KGPWTPDEDKRLRDYVEAHGEGNWNQVQRNAGLNRCGKSCRLRWTNHL 149
                      79*******************************************996 PP

2Myb_DNA-binding39.41.4e-12155198146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + ++++eE ++++ ++ ++G++ W++Ia+ m  gRt++++k++w++
  LPERR06G17110.1 155 KEPFSKEEVDQIISLHYLMGNK-WSRIAKAMT-GRTDNEIKNFWNT 198
                      579*******************.********9.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.05697153IPR017930Myb domain
SuperFamilySSF466892.32E-3099196IPR009057Homeodomain-like
SMARTSM007172.6E-16101151IPR001005SANT/Myb domain
PfamPF002491.0E-16102149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-23103157IPR009057Homeodomain-like
CDDcd001673.87E-12104149No hitNo description
SMARTSM007175.2E-13154202IPR001005SANT/Myb domain
PROSITE profilePS5129415.586154204IPR017930Myb domain
PfamPF002492.0E-11155198IPR001005SANT/Myb domain
CDDcd001671.58E-9157198No hitNo description
Gene3DG3DSA:1.10.10.604.2E-21158202IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MRMKSAEERE RDRALGLPLP ETEETNMVDF MTESPAMLYP SGDDVDEDNN DETDVDSSSS  60
DGGDDDQGHR GGGARARVSA GHRGGGSVLL RRRVGGEIPL KKGPWTPDED KRLRDYVEAH  120
GEGNWNQVQR NAGLNRCGKS CRLRWTNHLK PELKKEPFSK EEVDQIISLH YLMGNKWSRI  180
AKAMTGRTDN EIKNFWNTRC KRIQKSGEPL YPKDSLSFQV KEESNCRSPD ESRGMKRTNA  240
DLQGSGLHNE MVVFKSYDYN RAENIFPTNF VAPNSLSIDT INSFKHQEFV GIVPPVCNGN  300
EQISDDTEKI GCTTNFNSGI QHQSIPFGTV SEHPTLVDNF STSGTIQSPM NVELPSLQFP  360
NYDLSNNAWL GHPIEQVDSV LQSPASMRSG SLSPKNTGPL DALVYGGQGL GDCTELQRSF  420
DVFVPPVSYD QVINSNTFSM SSSSLVLGDD LLKSSLDPFA GSNSNADNLF FDSHPPPLVD  480
TISWRHGPSL EASLFPEEGL HSSEQLAKNM FNPFVDGDYF DETNLRDFPN E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-261002025106B-MYB
1h8a_C8e-2610020225126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657115.11e-162PREDICTED: transcription factor GAMYB-like, partial
TrEMBLA0A0D9WRX50.0A0A0D9WRX5_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g40330.11e-152(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129022331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.13e-49myb domain protein 65